PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01598.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 256aa    MW: 27915.8 Da    PI: 11.0651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01598.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.16.2e-11550148
                                  TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+W++eEd l+   ++++G g +W +  +t++  R++ +c+srw++yl
  Zmw_sc01598.1.g00130.1.am.mk  5 KGKWSKEEDRLIRSHIEKHGIGrSWQA-LSTLQ--RCGRSCRSRWLNYL 50
                                  79******************999****.77887..9***********97 PP

2Myb_DNA-binding35.13e-1157100247
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   g++T+ Ed+++ +   ++G+  W+ I + ++ gRt+  +k++w++ 
  Zmw_sc01598.1.g00130.1.am.mk  57 GNFTPAEDKIICEMYSKMGSC-WSVITAQLP-GRTDLAVKNYWNST 100
                                   89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.126150IPR017930Myb domain
SuperFamilySSF466891.26E-24397IPR009057Homeodomain-like
SMARTSM007172.2E-7452IPR001005SANT/Myb domain
PfamPF002491.3E-9550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-18657IPR009057Homeodomain-like
CDDcd001671.78E-8750No hitNo description
PROSITE profilePS5129418.06951105IPR017930Myb domain
SMARTSM007177.0E-1155103IPR001005SANT/Myb domain
PfamPF002499.1E-1057100IPR001005SANT/Myb domain
CDDcd001676.47E-858101No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2158104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVMKKGKWSK EEDRLIRSHI EKHGIGRSWQ ALSTLQRCGR SCRSRWLNYL RPGLKHGNFT  60
PAEDKIICEM YSKMGSCWSV ITAQLPGRTD LAVKNYWNST LKKRFRPAAR TAAFARRRPH  120
PSPTASTSDA GTPARDLQLV VHSDESSTAG SSCAQPILPS SPTSVKAVHP LGPVGAGREP  180
IEAVPVRVSA PVRTEVGGAA SDDANGAATT GKEWSDRWDG HGHHLRAHVT PPSGLHGPRA  240
GLLMRVRRHP QLLALV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-23310525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.13e-78PREDICTED: transcription factor RAX2-like
TrEMBLM0YS592e-68M0YS59_HORVD; Uncharacterized protein
STRINGMLOC_72262.25e-68(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638